Nissan electric campervan for sale. 9 petrol auto kampa rear conversion nissan serena 1.
Nissan electric campervan for sale 2025 Nissan Camper Van: A New Era of Adventure on Wheels . Jan 21, 2021 · Here in 2021, delivery vans are going electric, which means the camper van world should follow suit shortly. Feb 23, 2023 · The PacWesty eTofino is an adventure ready class B electric pop top camper offering space, functionality and reliability. Building a fully-featured campervan within the compact Nissan NV200 required innovative thinking and resourcefulness. toyota. Full seat with rotation etc E. sussexcampervans. A diesel campervan adventure is a lower carbon option than an overseas holiday, but we dream of carbon-neutral journeys, silent engines and fresh air. Browse the best March 2025 deals on Nissan NV200 vehicles for sale. The van is in good condition, with a smooth-running engine and tidy bodywork showing only minor wear consistent with its age. Flexible Seating for Everyday Needs. £16k ono Comes with Rib Altair 112 May 12, 2023 · The Nissan NV200 is becoming more and more in demand, so you will want to enquire about this gorgeous campervan before it gets snapped up! We have had this van for just over 2 years and have loved travelling the length and breadth of the country in it with no issues. Import papers and Japan registration Please contact if any clarification NO SCAMERS PLEASE Feb 21, 2023 · Nissan NV400 L2H2 6 speed manual automatic 2. Ready for adventure? This white Nissan eNV200 campervan is your perfect travel companion, offering comfort, practicality, and eco-friendliness. Defender. 1994 C. Have a used Camper Van for sale? Place your Camper Van in front of thousands of monthly visitors today. New Conversion, low mileage, and in great condition. ” — Tricia Bond Nissan eNV200 Micro Camper Campervan Conversion Van Conversion Vanlife Electric Campervan EV eNV200 Campervan Handbuilt Campervan nissan. Used Nissan Electric Cars for Sale; New Nissan NV 2500 HD SV high roof home built camper van. After trialling several designs, we perfected a practical and nimble camper with thoughtful features, including our custom rock ‘n’ roll bed. Perfect for eco-friendly camping adventures. Nissan, for one, is leaning into it: the brand has just unveiled an all-electric pop-top camper concept, the e-NV200 Winter Camper, which the company says will “bring spark to frosty adventures. honda stepwagon 1. For a compact vehicle, the e-NV200 offers a lot of load space, which we’re able to build a fantastic Love Campers design into. ULEZ COMPLIANT. Buy Now For £33,995. See YouTube Video below for Full Tour 200w Solar 12v Outlets Recently replaced h Camper Van For Sale: 2014 NISSAN NV2500 S in Santa Cruz, California Registered on V5 as Van/Side windows. Jan 27, 2021 · Nissan has unveiled a new electric “winter camper” van concept based on its e-NV200 electric van. Van Viewer is the ultimate place to buy or sell your Camper Van. Nissan Serena. Apr 19, 2023 · Low mileage 1. While Tesla hasn’t officially announced a campervan, the demand for electric and sustainable travel has led to many speculations and concept designs. Key Features: Electric Vehicle: Quiet, smooth, and economical with a range of up to 160 miles. 9 petrol auto kampa rear conversion nissan serena 1. 9 petrol honda nano camper auto Feb 28, 2024 · For sale is a well looked after, low mileage 2004 Nissan Elgrand E51 Campervan conversion. Has been an amazing vehicle and I’m genuinely sad about letting her go. Serviced November ’22, MOT expires December ’23. The van is mechanically sound and has been maintained regardless of cost by both myself and the previous owner. – Electric windows – Parking camera Rent out your campervan; Campervans for Sale; Sell your Campervan; Find amazing local prices on used Electric campervans & motorhomes for sale Shop hassle-free with Gumtree, your local buying & selling community. Camper Van For Sale: 2015 Nissan NV200 Vanlab Campervan for sale in Vista, California. The e-NV200 Combi is its five or seven-seat electric people carrier. Selling my 2017 Nissan NV3500 - custom built Adventure Van / camper van. Diesel intercooler turbo B. Winnebago’s commercial electric RV will have a range of 85 to 125 miles, a distance that’s too short for long-haul camping trips. Selling a van? Select a basic or premium listing to get your van in front of thousands of buyers today! Why Vanlife Trader? With over 80k users per month and 195k followers on instagram, tapping into our audience guarantees mass exposure for your rig. It was on sale from 2014 to 2022 alongside the e-NV200 panel van and shares technology with the Leaf. MOT AUG 26. 00 USD Unit price / per . ONLY BOUGHT LAST SUMMER, SADLY SELLING DUE TO HEALTH Sep 23, 2021 · Electric small NV200 camper van – e-NV200 Somehow the chosen music just doesn’t fit the car… the car is too child-like for such pensive music… Nissan NV200 camper & microcamper conversions gallery For Sale: White Nissan eNV200 DIY Campervan. Electric curtains F. Whether you’re searching for a Nissan camper van or campervans for sale near you, we’ve got you covered! This page is all about Nissan campervans for sale, including both second-hand and Nov 7, 2024 · Year: 2011 Transmission: Manual Fuel: Diesel Engine Size: 1461CC Mileage: 114,000 miles. Find Nissan Elgrand used motorhomes for sale on Auto Trader, today. Only 40k miles, and ready for many more! Sep 17, 2024 · Look no further than the Nissan e-NV200 Campervan! This versatile electric van is perfect for those who want it all: a family-friendly 7-seater, a spacious cargo van, and a fully functional camper, all in one compact package. Immaculate condition. The 39 litre fridge provides enough space to chill the essentials for a day out, weekend away or maybe just a few bottles of beer and wine for when you have reached the campsite and the driving is finished for the day! Find amazing local prices on used Nissan campervans & motorhomes for sale Shop hassle-free with Gumtree, your local buying & selling community. Jul 25, 2018 · This week, Nissan launched the new e-NV200 all-electric van using the same new 40 kWh battery pack introduced in the next generation Leaf. 2012 Nissan NV2500 High Roof V8 Campervan – Adventure-Ready or a Blank Canvas Looking for a reliable, well-equipped campervan or a solid base for your dream project? This 2012 Nissan NV2500 High Roof V8 Van is the perfect combination of performance, comfort, and versatility. We will be sad to see it go but unfortunately we have outgrown it with our expanding family and will be upsizing! Great running camper that has never let us down. Need to get something more practical due to another child on the way, and it won’t get used. The electric hook up point is concealed under the rear bumper. 00 USD Sale price $2,424. The power unit provides optimized Feb 16, 2025 · BOUGHT FROM FREE SPIRIT CAMPERVANS, INCLUDES WARRANTY. A great 2 person Campervan, that has done us proud. 5L diesel engine and 5-speed manual transmission, offering excellent fuel efficiency of up to 56 MPG. Save $6,965 this March on a Nissan NV200 on CarGurus. com for full features and specs of the Envy model --Low miles (approx. 6 petrol auto – single nissan e-nv200 electric campervan nissan serena 1. Electric bikes; Nissan NV200 1. Nissan e-NV200 electric van. Split charger to leisure battery Battery indicator 12 volt USB MOT till March 2025 2 electric sockets Electric hook up Milage 124222 Cladding and carpet finish Single bed converts to. In our view the Nissan e-NV200 is one of the best vans on the market when it comes to value for money. 3 litre turbocharged diesel engine (162hp) (averages 40-42mpg mixed driving) Full 12 month MOT with sale Cruise control Air conditioning Electric windows Electric mirrors. Used. Feb 6, 2024 · Not only is my van conversion beautiful and unique it has proved to be a competent, on and off grid, mini camper. The new model is called the ID. Although fully equipped for holidays and trips away these compact Nissan's are the perfect choice for a primary vehicle and local day trip van. Pre-owned Aug 25, 2024 · NISSAN NV200 TEKNA. Feb 7, 2024 · This is an advert for an example base vehicle which we can supply. Roadtrek took a 2012 Nissan NV-2500 cargo van and converted it to a camper van. Can campervans be 100% electric? Yes! We already have a small but growing collection of 100% electric vans available for hire on our Electric Campervans page. Factory fitted reversing camera to help with those tight parking spots. Sale Sold out Free Shipping The TNT vans Nissan NV Campervan Conversion Kit Photo: Touring magazine. Includes: 30 litre domestic drawer fridge Glass lid and sink combo Cold water tap and and 12V water pump – 12 litre fresh water container Find Nissan used motorhomes for sale on Auto Trader, today. 5L ‘Mistral Highway STAR’ , Automatic, Petrol, 68L fuel tank UK registration 2021, Reg: HS08 KKX Introducing the Nissan NV200 CamperCar from Sussex Campervans. Apr 16, 2023 · Forget Hollywood - Franky is ready to take you on a love story of your own 🚐 ️ Based in London, this beachy-meets-mountain-chic camper is your ticket to the ultimate romantic escape. Nissan is stepping up its game in the camper van market with the 2025 Nissan Camper Van, designed for travelers who seek both comfort and reliability. com/our-vans/nissan-vxeNot quite ready to go fully electric?Brand new to the Sussex Campervans lineup for 2022, the Nissan NV200 petrol Jun 8, 2018 · The e-NV200 is clearly the most interesting in Nissan's new camper van lineup, but Nissan shows gas NV200 and NV300 models in its photos while stating that the modifications will also be available Dec 5, 2023 · With unbeatable looks and unparalleled performance, the Nissan Elgrand Velocity is a hi-spec, hi-powered campervan conversion that sleeps four adults. Registered as a Motor Caravan. This highway star offers class and comfort in one of the world’s most luxurious but incredibly good-value campers. Used Nissan Vans for Sale. and side board Storage under bed and sink Reversing camara Air evolution Air awning available for £200 if www. This van is the ultimate leisure vehicle and can also make a great business rental. Nationwide. 2021 Nissan NV200 mini cargo van converted with GTRV Westy full camper package. 5 Rock & Roll bed front swivel seat LEZ COMPLIANT VEHICLE. Electric bikes; Nissan Elgrand Camper Van 3. Based on the e-NV200 Evalia, the e-NV200 Winter Camper benefits from Nissan’s proven electric powertrain technology. Buzz Camper Van. Seller's Description--Recon Envy model built on a 2020 Nissan NV 200 Van-- see reconcampers. DIY Camper Conversion: Plywood detailing with stylish black For Sale: 2019 Nissan NV200 - Adventure-Ready Camper Van! Embrace the great outdoors with this versatile 2019 Nissan NV200, expertly converted for overnight getaways and weekend trips! This compact yet spacious van features all the essentials for a comfortable camping experience. The 2025 Tesla Campervan: Electrifying the Road Trip . Dive into our extensive listings on the UK's leading leisure vehicle platform, where finding the perfect campervan is made simple. The new camper vanette rolls the homey tranquility of Camper Van For Sale: 2014 NISSAN NV2500 S for sale in Santa Cruz, California. 1. With only 55,000 miles from new, this micro camper makes the perfect get away vehicle. The engine has 105k miles (169k KM) on the clock and has been recently serviced. One owner, very well maintained with service records. 5 liter V6 186BHP. Find amazing local prices on Nissan campervan for sale Shop hassle-free with Gumtree, your local buying & selling community. About Campers4Sale. Feb 13, 2025 · Professionally converted by Northstar conversions in 2022. Buzz Camper Van. A. Used Nissan Electric Used 2019 Nissan Campervan Automatic Electric For Sale On Campers4sale - Thousands Of Leisure Vehicles In Just One Place. Regular price $2,552. Aug 22, 2024 · Included in sale is spare carpet left over from lining, in case of any tears in future. With the best range of second hand Nissan Caravan Campervan motorhomes across the UK, find the right motorhome for you. 9 petrol auto nissan serena 1. Contact us for more information! Jan 21, 2024 · For Sale: Nissan NV200 Campervan. Good condition, no mechanical problems, cosmetic damage under passenger side doors and some warping on the rear panels. *Warranties: Nissan NV200 sv - 5yrs/100,000 miles does NOT include upfit for campervan Products for upfit were 1-2yr warranties User manuals are included New owner will have to obtain temporary tags through their local DMV as law requires the current license plate to be removed upon vehicle sale. New engine room wiring harness, catalytic converter, and battery. First Registered 20 January 2020. Rebuilt title. Unlike many so-called electric campers, the e-NV200 is genuinely eco-friendly, eliminating the need for LPG, diesel, or petrol. Built on a Dodge Ram ProMaster chassis, the eTofino has two sleeping areas thanks to the pop top, ample storage, convertible sofa bed and a kitchen area with a refrigerator and induction cooktop. Key Features: Nissan's MyRoom light camper concept moved to full-on production earlier this year and has now spawned a smaller version, the NV200 MyRoom. Great family camper van as it seats 4 (with 3-point seat belts) with a 42" x 72" lower bed and a 40" x 83" bed board in the pop-up tent, yet fits into Camper Van For Sale: 2017 Nissan NV200 Recon Weekender Jan 16, 2015 · Opening the rear door reveals more storage and also the gas bottle. Each campervan is distinct, designed to cater to various needs—be it a family adventure or a cozy getaway for two, complete with modern amenities like toilets, showers, and heating. The e-NV200 was a long-term project for the Horsham-based firm and they have succeeded in producing a practical true electric camper to rival the fossil drinkers in style, power and range. Nov 13, 2024 · Nissan NV200 converted campervan/ day van. Nissan RVs For Sale: 4 RVs Near Me - Find New and Used Nissan RVs on RV Trader. 5 dCi Acenta camper van poptop. Aug 8, 2024 · We are starting to see a few companies looking to enter the camper and motorhome segments with all-electric options. With 12 months left on the MOT, this camper is ready to take you on adventures all over the UK and more. The van is ULEZ and Clean air zone compliant and benefits from excellent mileage, achieving up to 60 MPG. 9 petrol honda nano camper auto Find used Nissan e-NV200 vans for sale on Auto Trader, today. No Rust. Embark on your adventures with this meticulously maintained and thoughtfully outfitted Nissan NV200 Campervan, ready to be your home on wheels. 2014. Given Tesla’s reputation for innovation and electric vehicle dominance, a Tesla campervan would undoubtedly be a game-changer in the RV Nov 18, 2024 · A reliable and economical Nissan NV200 van with a 1. 2021 ULEZ compliant. Yes, the e-NV200 is fully electric—no fuel tanks, no hybrids, just clean, renewable energy. Campers For Sale Electric Cars FAQ's Latest Smaller campervan based on the Nissan NV200. Conversion by Simon Lee Conversions, Stockton-on-Tees Explore our new Nissan NV200 campervan conversions for sale. 2020 19,000 miles Trade Electric 1 cc nissan. Nissan is now testing the waters by unveiling an all-electric camper based on Find and save ideas about electric campervan on Pinterest. Full side conversion + pop top- Professional conversion done in Feb 2020, 4 berth with rock and roll seats, Fridge, Water basin, Gas burners x2, Imported and registered 2017, 85,000 miles, Pearlescent white body, cream and grey interior, Undersealed, AC, Electric windows/central locking, MOT until January This Nissan Elgrand Campervan is a pearlescent white color that sparkles in the sunlight and has a 3. 9000 at time of listing) and very clean and gently used by single owner --Original Owner --2020 Nissan NV200 SV purchased new from Nissan dealer and transported directly to Recon (Reconcampers. Also included are windscreen and cab window thermal covers. Looking to really wild camp, start here! Kombi. Browse the best deals on used electric cargo vans for sale. 9Litre Petrol Automatic 2009 - Campervan, 2 berth, 4 seater. Find Nissan Caravan Campervan used motorhomes for sale on Auto Trader, today. Van Viewer is the nation’s largest Camper Van For Sale marketplace. Ready to buy an affordable Camper Van for sale? We can help with that too, browse over hundreds new and used Camper Vans for sale nationwide. Jan 25, 2022 · An opportunity to own one of the worlds first all electric campervans. While Nissan’s electrification effort is mostly known through Jan 20, 2021 · Part of the Nissan Original Accessories range widely available in Europe, the van’s front and rear mudguards, door entry guards, side bars and rubber mats offer protection and convenience. The ID. Apr 14, 2024 · Genuine reason for sale. 117,177 miles. The Camper van has an MOT till 13 Feb 2025. Working with carefully planed solid reclaimed timber that’s typically around 100 years old, finished using traditional woodworking methods, our conversions Jan 20, 2021 · Nissan Original Accessories, including front and rear mudguards, door-entry guards, side bars and rubber mats are also fitted, offering protection and convenience whatever the task at-hand. Save on electric cars on CarGurus. Discover your ideal Nissan campervan for sale today on the UK’s largest dedicated leisure vehicle classifieds website. V6, 4. Aug 30, 2023 · With a new generation of all-electric vans, like the Ford E-Transit, Volkswagen ID. By day, gather around the spacious dining area (seats six!), and by night, sink into a super cosy full-sized double bed with Egyptian cotton sheets. honda. double Sink. Buzz is a brand-new van from Volkswagen that was originally set to be released in October 2022. Imported/converted by Herford Campers. Insulated, fixed window, sliding opening window, 2 rear windows, passenger swivel plate, kitchen unit with sink and 2 burner hob, wardrobe, 40 Ltr Compressor Fridge, 240v Electric System and charger, 12v Leisure battery, rock n roll bed upholstered, elevating roof, gas box,bottle and regulator, table and table rail, silver screen, awning rail. Based on the Nissan e-NV200, Sussex Campervans have created their all-electric campervan and we are seriously impressed. Jan 20, 2021 · The e-NV200 Winter Camper is powered by the same 40kWh electric battery as the e-NV200 Combi, which can recharge to 80% from empty in 40-60 minutes, and a 107bhp electric motor good for 0-62mph in Apr 19, 2022 · Built originally in 2005 and registered in UK in 2017 Nissan Elgrand AUTOMATIC PETROL. Nissan NV200 & eNV200 Camper Vans As small as a compact hatchback - yet can accommodate 4 travelling and sleeping with a fully functioning side kitchen - the NV200 design is an example of the Thistle Rose Leisure design philosophy of making everything practical and practically using every cubic centimetre! Jul 24, 2018 · But despite these gains, RVs have had a hard time going electric thanks to one crucial problem: range. Based on the e-NV200 Combi, the e-NV200 Winter Camper benefits from Nissan’s intelligent and efficient electric powertrain technology. This is the standard factory produced Roadtrek NAV-6 Active layout. Find amazing local prices on used Nissan NV200 campervans & motorhomes for sale Shop hassle-free with Gumtree, your local buying & selling community. 2018 Nissan brought zero-emissions motoring to the masses with its first-generation Leaf – a model that enjoyed huge sales success around the world. Find Nissan NV200 used motorhomes for sale on Auto Trader, today. Explore the all-electric Nissan e-NV200 camper van from Sussex Campervans. Compact design with high-spec features for your camping needs. Named a top 5 electric campervan in 2022 by Discover Touring, it’s the result of years of dedication at Sussex Campervans. This new model combines Nissan’s signature durability with modern technology and smart design, making it an ideal choice for road We carry out complete start to finish camper conversions of the petrol automatic & diesel manual Nissan NV200 and the fully electric eNV200, in both the combi and the panel van models. Manual gearbox and Right-hand Drive with 42,235 miles. 6 petrol auto nissan nv200 1. nissan nv200 1. Dual Air conditioner J. The fourth rear seat has been removed to open up the cabin, but comes with the van and is in perfect condition. Power moon roof G. Search over 690 used Nissan Vans. The Nissan e-NV200 has been available since 2014, which means we’ve had plenty of practice with kitting it out as an electric campervan. With a reliable track record and a mere 101,000 miles on the clock, this van is ready for new journeys and unforgettable experiences. The van comes with a complete service history and 3 month warranty on the vehicle itself (there is also a 1 year warranty on the campervan conversion). Navigation system, aux and USB connections, backup camera. – Heat shield covers for all 3 front windows, specifically for the Nissan NV2500 – propane buddy heater (portable) – cell booster – surecall (works like a charm) Discover the best campervans, motorhomes, RVs and campers for sale on Vancamper America's #1 free to list marketplace for buying and selling campervans and custom camper conversions. Available on iPhone, Android and web. One UK owner V5 registration as a Motor Caravan March 2025 MOT 3500cc petrol V6 engine- very fun to drive Underseal- extensive coating of black underseal We converted our very first camper to travel in across Europe and Northern Africa over ten years ago, since then we’ve established our Wild Van workshop, honing our skills and refining our designs, to become one of the countries leading specialists in Nissan NV200 and electric eNV200 camper conversions. . 170000KM D. 2012 Nissan NV2500 HD Roadtrek Pop Top Camper Van. toyota alphard mk 1 toyota alphard-vellfire mk 2. ” (Get it?) Read More Nissan e-NV200 40KW, FULLY ELECTRIC CAMPERVAN, OFF GRID. 9 petrol hybrid auto. The Nissan Dalbury is a Hillside Leisure conversion that has been completed to the highest standards. 4 days ago · for sale by owner > rvs. 2015 Nissan NV200 SV Camper Van - 83K Miles - Custom Build by VanLab - $2 2015 Nissan NV200 SV Camper Van - 83K Miles - Custom Build by VanLab - $23,000 Location: Vista, CA Looking for a reliable camper van that’s ready fo Jan 8, 2025 · Electric windows and 2 sunroofs! (1 of which is electric) Electric Curtains. With Zero Emissions, Ulez Free and Tax Free, this is the contemporary way of going on your travels either as a day van or further afield. Alloy wheels H. A beautiful Nissan Elgrand Campervan for sale for £25,995 from Carefree Campers. Find out more. 61k miles (may increase), Full service history, comes with accessories. Maximum range estimate: 100 Miles in winter, 130 miles in summer* This e-NV200 charges in around 19 hours with a standard 3pin Jan 6, 2025 · This is a lovely example of a 2010 Nissan NV200 Micro Camper. To showcase the new vehicle, Nissan had it attempt to Nissan Caravan GT cruise intercooler turbo camper JDM right hand drive van. Partial service history: Annual service stamps up until 2019, when full service including cambelt and water pump was carried out at 106k. Buy Nissan Campervan and get the best deals at the lowest prices on eBay! Great Savings & Free Delivery / Collection on many items Campervan for Sale. 1 owner. The Nissan e-NV200 is designed with your daily life in mind. AUTOMATIC - NISSAN E-NV200 TEKNA 40 KW 2020 OFF GRID, FULLY ELECTRIC CAMPER VAN. Nissan NV200 2016, 2 berth motorhome for sale in Devon. Production is currently underway in Germany for an electric version of the Volkswagen camper van. post; Beautiful & Loved Camper Van-2018 Nissan NV 2500 - $38,000 This van has a great solar set up and can run an electric Apr 21, 2023 · The Electric ID. New Conversion, has low mileage, and is in great condition. The body work and interior is in excellent condition. 6 petrol automatic. Based on a factory Nissan E NV 200 this is the dream green touring van. With a full clean MOT and 2 former keepers it has been well maintained. BRAND NEW 2024 CONVERSION . com) in Milwaukee for their late 2020 build. 0 L. 5 Rock & Roll bed front swivel seat LEZ Fully Electric camper conversion available at The Bedfordshire Car and Caravan Centre. Book a bespoke build today. TrueCar has over 712,838 listings nationwide, updated daily. This is why electric camper vans have so far been relegated to concept cars or limited edition one-offs at expos. 2018 (68 reg) | 25,000 miles Feb 17, 2023 · Additional Items, seller is adding FREE with sale: – Viper alarm system with GPS tracking if van is stolen (requires a yearly membership). With the best range of second hand Nissan e-NV200 vans across the UK, find the right van for you. Buzz and Mercedes EQV, taking root in the e-camper van market, Nissan's electric small vans have gotten lost in Feb 18, 2025 · Make/model: NISSAN Elgrand – E51 (White) 2008, 2. The vehicle is in excellent mechanical condition, well maintained, very re Camper Van For Sale: 2017 Nissan NV3500 - Custom Built Adventure Van / May 28, 2024 · Brand new MOT (May 2025). Nissan NV200 RVs For Sale: 0 RVs Near Me - Find New and Used Nissan NV200 RVs on RV Trader. wyyehppnyxhbbdcdrgmlirenhmfedhftvgeshaentawdftymvzljltkgdaenbxfytkkbaobthxhugpvnkumh